PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C012926P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 229aa    MW: 25970.2 Da    PI: 7.4611
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C012926P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.9e-18956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll+ +v+  G g+W+++ar  g++Rt+k+c++rw++yl
   MELO3C012926P1  9 KGPWTAEEDSLLYTYVTVNGEGHWNSVARSTGLKRTGKSCRLRWLNYL 56
                     79********************************************97 PP

2Myb_DNA-binding46.96.4e-1562105146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T +E++l+++++ ++G++ W++Ia+ ++ gRt++++k++w++
   MELO3C012926P1  62 RGNITLQEQLLILQLHSRWGNR-WSKIAEFLP-GRTDNEIKNYWRT 105
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.692460IPR017930Myb domain
SuperFamilySSF466891.76E-307103IPR009057Homeodomain-like
SMARTSM007174.4E-14858IPR001005SANT/Myb domain
PfamPF002492.5E-15956IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-211063IPR009057Homeodomain-like
CDDcd001671.24E-91156No hitNo description
PROSITE profilePS5129418.20761111IPR017930Myb domain
SMARTSM007171.7E-1361109IPR001005SANT/Myb domain
PfamPF002497.5E-1462105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2164110IPR009057Homeodomain-like
CDDcd001672.05E-682105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MGSNDDVKKG PWTAEEDSLL YTYVTVNGEG HWNSVARSTG LKRTGKSCRL RWLNYLRPNL  60
RRGNITLQEQ LLILQLHSRW GNRWSKIAEF LPGRTDNEIK NYWRTRVQKQ AKQLNCDVNS  120
QRFRDAMRLV WIPRLVERIE AATSAQSPPP PPPPPPPPPP PLLAPCIDTD TSTSTWEHKS  180
IVAPDHVSGS YSDTSDLTGG WWEGDGVESS LECLWTEENI CFLQHILN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-24411122128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818270.0LN681827.1 Cucumis melo genomic scaffold, anchoredscaffold00018.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008447462.11e-169PREDICTED: transcription factor MYB108
SwissprotQ9LDE14e-69MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0A0L8621e-127A0A0A0L862_CUCSA; Uncharacterized protein
STRINGGLYMA03G38040.14e-86(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.12e-70myb domain protein 108